(data stored in ACNUC7421 zone)

EMBL: CP002293.PE51

CP002293.PE51        Location/Qualifiers
FT   CDS             59991..63524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0051"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   transcription factor CarD; DEAD/DEAH box helicase domain
FT                   protein; helicase domain protein; TRCF domain protein;
FT                   KEGG: gwc:GWCH70_0050 transcription-repair coupling factor;
FT                   SMART: DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72907"
FT                   /db_xref="GOA:A0A0F6BHK6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK6"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ADP72907.1"
FT                   /translation="MRSLHRYFAENQDIRSIIGGIEAGLKEQLIVGLSGSARSVFISSL
FT                   YKETDRPLLVITHNLFQAQKIYDDLVQLLGTEEVFLYPVNEVIATELAIASPELKAQRL
FT                   EVMNYWTKRDKGVVICPVAGLRRLLPPVSLWKNNILTLEVQQNIDVEYCKKQFVQMGYK
FT                   RVATVSAPGEFSVRGGIIDIYPLTAELPYRIELFDTEIESIRTFTADDQRSRDEVRQIT
FT                   IGPADEMIVYGEMLERGIARIEAGLTESLHKLKDEKAKQLLLEHISSELEQLKQGQEIE
FT                   QQYKYMALFYEEPASLLDYMPENGILLMDEMSRLQEAAESLDKEEAEWYTSLLSEGKII
FT                   HDVPISHSFSQLLQKHRKQRIYLSIFLRHVPHTRPENIVNISCKQMQNFHGQMSLLKSE
FT                   LERWKKAKYAVVFLTPNAERMKKLQSVLEDYEIDVAPLNREAVLMHGKYQMIEGDLNTG
FT                   FELPMQKLAVITEEELFKKRVKRPIRRQKLSNAERIKSYSELRVGDYVVHVNHGIGKYL
FT                   GIETLEINGVHKDYIHIQYQGSDTLYVPVDQIDQVQKYVGSEGKEPKIYKLGGSEWKKV
FT                   KKKVESSVQDIAEDLIKLYAEREASKGYAFSPDTEMQREFEAAFPYQETEDQLRSIEEI
FT                   KRDMESDKPMDRLLCGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHYETVRE
FT                   RFQGFPITVGLLNRFRTRKQQAETIKGLKDGTIDMVIGTHRLLSKDVQFKDLGLLIIDE
FT                   EQRFGVTHKEKIKQLKANIDVLTLTATPIPRTLHMSMIGVRDLSIIETPPENRFPVQTY
FT                   VMEYTPELVREAIERELAREGQVFFLYNHIEDIDVKAEEISQLVPEARVTYVHGRMSET
FT                   ELESTMLAFLEGQYDVLVTTTIIETGVDIPNVNTLIVYDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFTYRKDKVLNEAAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNILGAEQHGF
FT                   IDSVGFDLYSQMLKEAIEKRKGVKQEEAKHEITIDLEVDAYIPDTYISDGLQKIDMYKR
FT                   FKAVETMEDVEMLREEMLDRFGEYPDEVAYLFQIAEIKVYAKQTGVEVIKQQKQQVDIL
FT                   FAENASKEVEIQRLSKIGGQYGRLFGFGMDGSKLKIVLYIKDLKPQEWLMILYETLKEL
FT                   SGVKDEKSIIA"
     MRSLHRYFAE NQDIRSIIGG IEAGLKEQLI VGLSGSARSV FISSLYKETD RPLLVITHNL        60
     FQAQKIYDDL VQLLGTEEVF LYPVNEVIAT ELAIASPELK AQRLEVMNYW TKRDKGVVIC       120
     PVAGLRRLLP PVSLWKNNIL TLEVQQNIDV EYCKKQFVQM GYKRVATVSA PGEFSVRGGI       180
     IDIYPLTAEL PYRIELFDTE IESIRTFTAD DQRSRDEVRQ ITIGPADEMI VYGEMLERGI       240
     ARIEAGLTES LHKLKDEKAK QLLLEHISSE LEQLKQGQEI EQQYKYMALF YEEPASLLDY       300
     MPENGILLMD EMSRLQEAAE SLDKEEAEWY TSLLSEGKII HDVPISHSFS QLLQKHRKQR       360
     IYLSIFLRHV PHTRPENIVN ISCKQMQNFH GQMSLLKSEL ERWKKAKYAV VFLTPNAERM       420
     KKLQSVLEDY EIDVAPLNRE AVLMHGKYQM IEGDLNTGFE LPMQKLAVIT EEELFKKRVK       480
     RPIRRQKLSN AERIKSYSEL RVGDYVVHVN HGIGKYLGIE TLEINGVHKD YIHIQYQGSD       540
     TLYVPVDQID QVQKYVGSEG KEPKIYKLGG SEWKKVKKKV ESSVQDIAED LIKLYAEREA       600
     SKGYAFSPDT EMQREFEAAF PYQETEDQLR SIEEIKRDME SDKPMDRLLC GDVGYGKTEV       660
     ALRAAFKAIM DGKQVAFLVP TTILAQQHYE TVRERFQGFP ITVGLLNRFR TRKQQAETIK       720
     GLKDGTIDMV IGTHRLLSKD VQFKDLGLLI IDEEQRFGVT HKEKIKQLKA NIDVLTLTAT       780
     PIPRTLHMSM IGVRDLSIIE TPPENRFPVQ TYVMEYTPEL VREAIERELA REGQVFFLYN       840
     HIEDIDVKAE EISQLVPEAR VTYVHGRMSE TELESTMLAF LEGQYDVLVT TTIIETGVDI       900
     PNVNTLIVYD ADRMGLSQLY QLRGRVGRSN RVAYAYFTYR KDKVLNEAAE KRLQAIKEFT       960
     ELGSGFKIAM RDLSIRGAGN ILGAEQHGFI DSVGFDLYSQ MLKEAIEKRK GVKQEEAKHE      1020
     ITIDLEVDAY IPDTYISDGL QKIDMYKRFK AVETMEDVEM LREEMLDRFG EYPDEVAYLF      1080
     QIAEIKVYAK QTGVEVIKQQ KQQVDILFAE NASKEVEIQR LSKIGGQYGR LFGFGMDGSK      1140
     LKIVLYIKDL KPQEWLMILY ETLKELSGVK DEKSIIA                               1177
//

If you have problems or comments...

PBIL Back to PBIL home page