(data stored in ACNUC7421 zone)

EMBL: CP002293.PE510

CP002293.PE510       Location/Qualifiers
FT   CDS             566113..566358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADP73366.1"
FT                   /translation="MMLDKWHPPLVVKFLKFLKKKIPRTGHTVIHKHDRTEQEMPAITL
FT                   LHVPRPSLREARLNENKTMQPTQGVGFLFIKKKGRI"
     MMLDKWHPPL VVKFLKFLKK KIPRTGHTVI HKHDRTEQEM PAITLLHVPR PSLREARLNE        60
     NKTMQPTQGV GFLFIKKKGR I                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page