(data stored in ACNUC7421 zone)

EMBL: CP002293.PE511

CP002293.PE511       Location/Qualifiers
FT   CDS             complement(566469..567539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0535"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gwc:GWCH70_2891 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73367"
FT                   /db_xref="GOA:A0A0F6BIW6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73367.1"
FT                   /translation="MRHLVLLGGGYGNMRILLRLLPNHLPEDVHITLVDRVPYHCLKTE
FT                   YYALAAGTISDHHIRVPFPEHPRLTYRFGEVVNIDLDNQNVQLQDESSIPYDDLVIGLG
FT                   CEDKYHGVPGAETFTHSIQSIEKARAAYEALNNLPPGSIVGIVGAGLSGVELASELAES
FT                   RPDLHIKLFDRGERILPMFPKRLSNYVESWFHQHDIEIVRCSNITKVEERTLYNHDTPV
FT                   HCDVIVWTAGIQPNRVVRQLPVEKDKQGRVVLTKRHHIPGYENVYVVGDCASLPHSPSA
FT                   QLAEGQAEQIVQVLQKRWNGEEPPSEFPPIKLKGILGSLGRKHGFGLLADRPITGRVPR
FT                   LLKSGILWMYKYHNGY"
     MRHLVLLGGG YGNMRILLRL LPNHLPEDVH ITLVDRVPYH CLKTEYYALA AGTISDHHIR        60
     VPFPEHPRLT YRFGEVVNID LDNQNVQLQD ESSIPYDDLV IGLGCEDKYH GVPGAETFTH       120
     SIQSIEKARA AYEALNNLPP GSIVGIVGAG LSGVELASEL AESRPDLHIK LFDRGERILP       180
     MFPKRLSNYV ESWFHQHDIE IVRCSNITKV EERTLYNHDT PVHCDVIVWT AGIQPNRVVR       240
     QLPVEKDKQG RVVLTKRHHI PGYENVYVVG DCASLPHSPS AQLAEGQAEQ IVQVLQKRWN       300
     GEEPPSEFPP IKLKGILGSL GRKHGFGLLA DRPITGRVPR LLKSGILWMY KYHNGY           356
//

If you have problems or comments...

PBIL Back to PBIL home page