(data stored in ACNUC7421 zone)

EMBL: CP002293.PE514

CP002293.PE514       Location/Qualifiers
FT   CDS             568286..569140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0538"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="TIGRFAM: diaminopimelate epimerase; KEGG:
FT                   gwc:GWCH70_2888 diaminopimelate epimerase; PFAM:
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73370"
FT                   /db_xref="GOA:A0A0F6BIW9"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIW9"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADP73370.1"
FT                   /translation="MNQFSFTKMHGLGNSYIYVNMFEETIPESLLSLLAVKVSNVNTGI
FT                   GADGMILICPSKVAPVKMRIFNSDGSEGKNCGNGLRCVAKYVYEHGIVNDRSFFIETLS
FT                   GLVKAEVEVENGAVTNVTIDMGKPRLKRSEIPMVGPEAERVVAEPFEVDGQLYEITAVS
FT                   MGNPHVIFYVDDINQAAVTSLGPIVEKDKRFPEGVNVEFVEVVNDHELHFRVWERGSGV
FT                   TQACGTGACAAVVASVLNGKTARNKETIVHLAGGDLTITWTDEGNVRMTGPAETICTGV
FT                   YYY"
     MNQFSFTKMH GLGNSYIYVN MFEETIPESL LSLLAVKVSN VNTGIGADGM ILICPSKVAP        60
     VKMRIFNSDG SEGKNCGNGL RCVAKYVYEH GIVNDRSFFI ETLSGLVKAE VEVENGAVTN       120
     VTIDMGKPRL KRSEIPMVGP EAERVVAEPF EVDGQLYEIT AVSMGNPHVI FYVDDINQAA       180
     VTSLGPIVEK DKRFPEGVNV EFVEVVNDHE LHFRVWERGS GVTQACGTGA CAAVVASVLN       240
     GKTARNKETI VHLAGGDLTI TWTDEGNVRM TGPAETICTG VYYY                        284
//

If you have problems or comments...

PBIL Back to PBIL home page