(data stored in ACNUC7421 zone)

EMBL: CP002293.PE515

CP002293.PE515       Location/Qualifiers
FT   CDS             569202..569564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0539"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="KEGG: gwc:GWCH70_2887 iron-sulfur cluster assembly
FT                   accessory protein; TIGRFAM: iron-sulfur cluster assembly
FT                   accessory protein; PFAM: HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73371"
FT                   /db_xref="GOA:A0A0F6BIX0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX0"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADP73371.1"
FT                   /translation="MTDIVTLTEAAAFQIKDMMKEHEEEGAYLRIGVRGGGCSGLSYGM
FT                   GFDHERHEDDHEFEQHGIKILVDKDSAPILQGTVIDYKQSLMGGGFTINNPNAIATCGC
FT                   GSSFRTATNTGTPEQC"
     MTDIVTLTEA AAFQIKDMMK EHEEEGAYLR IGVRGGGCSG LSYGMGFDHE RHEDDHEFEQ        60
     HGIKILVDKD SAPILQGTVI DYKQSLMGGG FTINNPNAIA TCGCGSSFRT ATNTGTPEQC       120
//

If you have problems or comments...

PBIL Back to PBIL home page