(data stored in ACNUC7421 zone)

EMBL: CP002293.PE516

CP002293.PE516       Location/Qualifiers
FT   CDS             complement(569997..570989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0540"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gwc:GWCH70_2885 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73372"
FT                   /db_xref="GOA:A0A0F6BIX1"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX1"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73372.1"
FT                   /translation="MKEDPKIYDVTIIGGGPTGLFAAFYGGLRQMSVKIIESLPQLGGQ
FT                   LSALYPEKYIYDIAGFPKIRAQELINNLKEQMEQFAPTVCLEQSVEKLEKLENGTLKLT
FT                   TNKEIHYSKTVVITAGNGAFQPRRLELETAAQYEGKNLYYFINDLNQFKGQKVLVCGGG
FT                   DSAVDWSLMLEPIAEKVTIVHRRDKFRAHEHSVETLLNSTVNVKTPFVPVELIGDENGI
FT                   RQVVIEHVKDGSRETIDIDALIVNYGFISSLGPIKNWGLEIEKNSIKVNSKMETNIPGV
FT                   YAAGDICTYEGKIKLIACGFGEAPIAISSAKTYIDPTARMQPAHSTSLF"
     MKEDPKIYDV TIIGGGPTGL FAAFYGGLRQ MSVKIIESLP QLGGQLSALY PEKYIYDIAG        60
     FPKIRAQELI NNLKEQMEQF APTVCLEQSV EKLEKLENGT LKLTTNKEIH YSKTVVITAG       120
     NGAFQPRRLE LETAAQYEGK NLYYFINDLN QFKGQKVLVC GGGDSAVDWS LMLEPIAEKV       180
     TIVHRRDKFR AHEHSVETLL NSTVNVKTPF VPVELIGDEN GIRQVVIEHV KDGSRETIDI       240
     DALIVNYGFI SSLGPIKNWG LEIEKNSIKV NSKMETNIPG VYAAGDICTY EGKIKLIACG       300
     FGEAPIAISS AKTYIDPTAR MQPAHSTSLF                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page