(data stored in ACNUC7421 zone)

EMBL: CP002293.PE517

CP002293.PE517       Location/Qualifiers
FT   CDS             571279..572502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0541"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: gwc:GWCH70_2884 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73373"
FT                   /db_xref="GOA:A0A0F6BIX2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX2"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADP73373.1"
FT                   /translation="MIQLKKPNVVILGAGYGGLMTTVRLQKLVGMNEANITLVNKNDYH
FT                   YETTWLHEASAGTLHHDRVRYPISDVIDRNKVNFVKDTVVKILPDEKKVLMENGEIAYD
FT                   YLVIALGFESETFGIKGLKEYAFSISNVNAARQIREHIEYQFATYNTEEEKREERLTIV
FT                   VGGAGFTGIEFLGELVNRLPQLCREYDIDPHKVRVICVEAAPTALPGFDPELVEYAVGQ
FT                   LERKGVEFKIGTAIKECTPDGIIVAKGDDVEEIKAGTVVWAAGVRGSRVVDESGFEAMR
FT                   GRIKVDPFLRVPGREDIFVVGDCSLVINEETNRPYPPTAQIAMQEGELCAKNLAVLIRQ
FT                   QGELQPFRPDIKGTVCSLGHDDAIGVVFGKKLWGAKASFMKKMIDNRALYLIGGASLVM
FT                   KKGKFKFF"
     MIQLKKPNVV ILGAGYGGLM TTVRLQKLVG MNEANITLVN KNDYHYETTW LHEASAGTLH        60
     HDRVRYPISD VIDRNKVNFV KDTVVKILPD EKKVLMENGE IAYDYLVIAL GFESETFGIK       120
     GLKEYAFSIS NVNAARQIRE HIEYQFATYN TEEEKREERL TIVVGGAGFT GIEFLGELVN       180
     RLPQLCREYD IDPHKVRVIC VEAAPTALPG FDPELVEYAV GQLERKGVEF KIGTAIKECT       240
     PDGIIVAKGD DVEEIKAGTV VWAAGVRGSR VVDESGFEAM RGRIKVDPFL RVPGREDIFV       300
     VGDCSLVINE ETNRPYPPTA QIAMQEGELC AKNLAVLIRQ QGELQPFRPD IKGTVCSLGH       360
     DDAIGVVFGK KLWGAKASFM KKMIDNRALY LIGGASLVMK KGKFKFF                     407
//

If you have problems or comments...

PBIL Back to PBIL home page