(data stored in ACNUC7421 zone)

EMBL: CP002293.PE519

CP002293.PE519       Location/Qualifiers
FT   CDS             573341..573505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0543"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmj:P9211_11471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73375"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX4"
FT                   /inference="similar to AA sequence:KEGG:P9211_11471"
FT                   /protein_id="ADP73375.1"
FT                   /translation="MKHTGQTACYTAKETECAAFVGQGGNLPWMFKEINRIKMKRFLKI
FT                   DSLYLIQYT"
     MKHTGQTACY TAKETECAAF VGQGGNLPWM FKEINRIKMK RFLKIDSLYL IQYT              54
//

If you have problems or comments...

PBIL Back to PBIL home page