(data stored in ACNUC7421 zone)

EMBL: CP002293.PE52

CP002293.PE52        Location/Qualifiers
FT   CDS             63716..64252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0052"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: gwc:GWCH70_0051 transcriptional regulator,
FT                   AbrB family; TIGRFAM: stage V sporulation protein T;
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72908"
FT                   /db_xref="GOA:A0A0F6BHK7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK7"
FT                   /inference="protein motif:TFAM:TIGR02851"
FT                   /protein_id="ADP72908.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALFDSLGQPVLICDRDVFIAVAGVSKKEYLNKNVGPLVEK
FT                   AMEERNSVLHTEEGEAELVDGVSETWKSYTIGPIVANGDPIGAVVILSKDKVLGEVEHK
FT                   AVETAASFLARQMEQ"
     MKATGIVRRI DDLGRVVIPK EIRRTLRIRE GDPLEIFVDR DGEVILKKYS PISELGDFAK        60
     EYADALFDSL GQPVLICDRD VFIAVAGVSK KEYLNKNVGP LVEKAMEERN SVLHTEEGEA       120
     ELVDGVSETW KSYTIGPIVA NGDPIGAVVI LSKDKVLGEV EHKAVETAAS FLARQMEQ         178
//

If you have problems or comments...

PBIL Back to PBIL home page