(data stored in ACNUC7421 zone)

EMBL: CP002293.PE521

CP002293.PE521       Location/Qualifiers
FT   CDS             573965..574669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0545"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; KEGG:
FT                   gwc:GWCH70_2880 3D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73377"
FT                   /db_xref="GOA:A0A0F6BIX6"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX6"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADP73377.1"
FT                   /translation="MILLKNIVRRITMSLLFAMALLTTFQAISGVEAKVIVDKLYGVSS
FT                   FHTGYHFFDIWKEQQHVAIDAQWKYYEGRKKPQISSEKISQPPRLEEAIDWSKYPSKVV
FT                   VATGYTAGVESTGKTPNHPEYGITYSGVRVKRDLYSTIAADLNVFPIGTILFIPGYGYG
FT                   VVADKGGAIKGNRVDLYYDTVEDVYKYWGKKTVQVYIVKKGDGELSEEELKQLNENETM
FT                   QVFRQQYLQSKS"
     MILLKNIVRR ITMSLLFAMA LLTTFQAISG VEAKVIVDKL YGVSSFHTGY HFFDIWKEQQ        60
     HVAIDAQWKY YEGRKKPQIS SEKISQPPRL EEAIDWSKYP SKVVVATGYT AGVESTGKTP       120
     NHPEYGITYS GVRVKRDLYS TIAADLNVFP IGTILFIPGY GYGVVADKGG AIKGNRVDLY       180
     YDTVEDVYKY WGKKTVQVYI VKKGDGELSE EELKQLNENE TMQVFRQQYL QSKS             234
//

If you have problems or comments...

PBIL Back to PBIL home page