(data stored in ACNUC7421 zone)

EMBL: CP002293.PE524

CP002293.PE524       Location/Qualifiers
FT   CDS             577407..578027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0548"
FT                   /product="Putative phosphate transport regulator"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   gwc:GWCH70_2877 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73380"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIX9"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ADP73380.1"
FT                   /translation="MIFSPKKDVFFDLLFTISENVKEAAQYFVEYKINNISDLKEFARV
FT                   MKEYERKGDSYIHELVVELNKTFITPIEREDIHQLAMKMDDVLDGLEQCSARFEMFSFT
FT                   EIDDHMVKFFDNIYQSTIEIADALKLLSQKKLLDMRTHAIKIKDYETKCDEILRASIKN
FT                   LFVDQKDPIKIIQYKELYEMLEEIADSCEDVANTIETIIMRNA"
     MIFSPKKDVF FDLLFTISEN VKEAAQYFVE YKINNISDLK EFARVMKEYE RKGDSYIHEL        60
     VVELNKTFIT PIEREDIHQL AMKMDDVLDG LEQCSARFEM FSFTEIDDHM VKFFDNIYQS       120
     TIEIADALKL LSQKKLLDMR THAIKIKDYE TKCDEILRAS IKNLFVDQKD PIKIIQYKEL       180
     YEMLEEIADS CEDVANTIET IIMRNA                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page