(data stored in ACNUC7421 zone)

EMBL: CP002293.PE525

CP002293.PE525       Location/Qualifiers
FT   CDS             578045..579043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0549"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: gwc:GWCH70_2876
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73381"
FT                   /db_xref="GOA:A0A0F6BIY0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY0"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADP73381.1"
FT                   /translation="MDTVFLLTVLIVVFALAFDFINGFHDTANAIATSVSTRALSPRKA
FT                   IVLAATMNFIGALTFTGVAKTITKDIVDPFALENGSVVILAALTAAIAWNLITWYYGIP
FT                   SSSSHALIGSIAGAAVSAAGFDVLHYQGFLKILESLIISPFLALAVGFVIMSLFRAIFK
FT                   NANLTRTTKGFRMFQVITAAFQAYTHGTNDAQKTMGIITMALIAANYHTSSEVPEWVRI
FT                   SAAIAMGLGTSVGGWKIIKTVGGKIMKIRPVNGAAADLSSALVIFSATLLHLPVSTTHV
FT                   ISSSIMGVGAAQRVKGVKWGVAQRIVLTWIITLPVSALIAGFVYQIFKLFF"
     MDTVFLLTVL IVVFALAFDF INGFHDTANA IATSVSTRAL SPRKAIVLAA TMNFIGALTF        60
     TGVAKTITKD IVDPFALENG SVVILAALTA AIAWNLITWY YGIPSSSSHA LIGSIAGAAV       120
     SAAGFDVLHY QGFLKILESL IISPFLALAV GFVIMSLFRA IFKNANLTRT TKGFRMFQVI       180
     TAAFQAYTHG TNDAQKTMGI ITMALIAANY HTSSEVPEWV RISAAIAMGL GTSVGGWKII       240
     KTVGGKIMKI RPVNGAAADL SSALVIFSAT LLHLPVSTTH VISSSIMGVG AAQRVKGVKW       300
     GVAQRIVLTW IITLPVSALI AGFVYQIFKL FF                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page