(data stored in ACNUC7421 zone)

EMBL: CP002293.PE531

CP002293.PE531       Location/Qualifiers
FT   CDS             complement(583326..584486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0555"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gwc:GWCH70_2864 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73387"
FT                   /db_xref="GOA:A0A0F6BIY6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADP73387.1"
FT                   /translation="MYSFDDVIDRRNTHSLKWDATERIFGVKDVLPMWVADMDFPAPPA
FT                   VIEALNKRVEHGIFGYTIIPDSLKNAVKHWLQSRHQWEIETSWLSFSTGVIPAIATAIE
FT                   AFTNEEDRIVVLTPVYPPLFQLVKKHRRTLVTSSLRLAETQYEIDWDDFEEKIRGAKLL
FT                   VLCSPHNPGGRVWTKEELIKIGELCVEHGVIVISDEIHADLTLPPYQHVPFASIDPAFA
FT                   EKSVTCIAPTKTFNLAGLQAAAAIIPNETLKRQFNNVQQRQGILTLNTFAVAGAEAAYQ
FT                   HGGEWLDALLPYLQKNINRLCSYIETNLPKLRVIRPEATYLVWVDCRPLGKTERQLKQL
FT                   LLEKGKIAVEFGSKFGEEGRGFIRINIACPQKTLEDALHRLTAALQ"
     MYSFDDVIDR RNTHSLKWDA TERIFGVKDV LPMWVADMDF PAPPAVIEAL NKRVEHGIFG        60
     YTIIPDSLKN AVKHWLQSRH QWEIETSWLS FSTGVIPAIA TAIEAFTNEE DRIVVLTPVY       120
     PPLFQLVKKH RRTLVTSSLR LAETQYEIDW DDFEEKIRGA KLLVLCSPHN PGGRVWTKEE       180
     LIKIGELCVE HGVIVISDEI HADLTLPPYQ HVPFASIDPA FAEKSVTCIA PTKTFNLAGL       240
     QAAAAIIPNE TLKRQFNNVQ QRQGILTLNT FAVAGAEAAY QHGGEWLDAL LPYLQKNINR       300
     LCSYIETNLP KLRVIRPEAT YLVWVDCRPL GKTERQLKQL LLEKGKIAVE FGSKFGEEGR       360
     GFIRINIACP QKTLEDALHR LTAALQ                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page