(data stored in ACNUC7421 zone)

EMBL: CP002293.PE532

CP002293.PE532       Location/Qualifiers
FT   CDS             584592..584840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0556"
FT                   /product="Domain of unknown function DUF1871"
FT                   /note="PFAM: Domain of unknown function DUF1871; KEGG:
FT                   gka:GK2930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73388"
FT                   /db_xref="InterPro:IPR015053"
FT                   /db_xref="InterPro:IPR023162"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIY7"
FT                   /inference="protein motif:PFAM:PF08958"
FT                   /protein_id="ADP73388.1"
FT                   /translation="MNWQLLHAIRAWDPFGYGNDAYETEAVDVLQAVHDCDEPTTLAGK
FT                   IQAIYEFSFERKIPLNECIKMAKSLLAMKQAAACSLP"
     MNWQLLHAIR AWDPFGYGND AYETEAVDVL QAVHDCDEPT TLAGKIQAIY EFSFERKIPL        60
     NECIKMAKSL LAMKQAAACS LP                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page