(data stored in ACNUC7421 zone)

EMBL: CP002293.PE535

CP002293.PE535       Location/Qualifiers
FT   CDS             586745..587110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0559"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; KEGG:
FT                   gwc:GWCH70_2860 RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73391"
FT                   /db_xref="GOA:A0A0F6BIZ0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ0"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ADP73391.1"
FT                   /translation="MSNIEVGSIVKGKVTGIQPYGVFVELDRETQGLVHISEISHGFVK
FT                   NIKDYVNVGDEITVKVLSIDPHTKRASLSMRAVEEGQRNMRKRHVKVKMSLNPGFHTLK
FT                   EKLQEWIEQSKKEDLSK"
     MSNIEVGSIV KGKVTGIQPY GVFVELDRET QGLVHISEIS HGFVKNIKDY VNVGDEITVK        60
     VLSIDPHTKR ASLSMRAVEE GQRNMRKRHV KVKMSLNPGF HTLKEKLQEW IEQSKKEDLS       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page