(data stored in SCRATCH zone)

EMBL: CP002293.PE537

CP002293.PE537       Location/Qualifiers
FT   CDS             587535..588698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0561"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   gwc:GWCH70_2858 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73393"
FT                   /db_xref="GOA:A0A0F6BIZ2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ2"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADP73393.1"
FT                   /translation="MENFSFQNPTKLIFGKGQIEQLKEEIPRYGKKILLVYGGGSIKRN
FT                   GLYDEVMNLLNELKVEVTELPGVEPNPRLSTVRKGVEICKTEGIEFLLAVGGGSVIDCT
FT                   KAIAAGAKYDGDPWDFITKKVKVFEALPFGTVLTLAATGSEMNAGSVITNWETKEKYGW
FT                   NSPATFPQFSILDPTYTLTVPRDHTVYGIVDMMSHVFEQYFHHTANTPLQDRMCEAVLR
FT                   TVMEAAPKLVNDLQNYELRETILYCGTIALNGLLQMGLRGDWATHNIEHAVSAVYDIPH
FT                   AGGLAILFPNWMKHVLDENVSRFAQLAVRVFDVNPEGKAERDVALEGIEKLREFWSSIG
FT                   APSRLADYGIGEESLELIADKAMANGEFGKFKKLNRDDVLAILRASL"
     MENFSFQNPT KLIFGKGQIE QLKEEIPRYG KKILLVYGGG SIKRNGLYDE VMNLLNELKV        60
     EVTELPGVEP NPRLSTVRKG VEICKTEGIE FLLAVGGGSV IDCTKAIAAG AKYDGDPWDF       120
     ITKKVKVFEA LPFGTVLTLA ATGSEMNAGS VITNWETKEK YGWNSPATFP QFSILDPTYT       180
     LTVPRDHTVY GIVDMMSHVF EQYFHHTANT PLQDRMCEAV LRTVMEAAPK LVNDLQNYEL       240
     RETILYCGTI ALNGLLQMGL RGDWATHNIE HAVSAVYDIP HAGGLAILFP NWMKHVLDEN       300
     VSRFAQLAVR VFDVNPEGKA ERDVALEGIE KLREFWSSIG APSRLADYGI GEESLELIAD       360
     KAMANGEFGK FKKLNRDDVL AILRASL                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page