(data stored in ACNUC7421 zone)

EMBL: CP002293.PE538

CP002293.PE538       Location/Qualifiers
FT   CDS             588858..590207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0562"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="KEGG: gwc:GWCH70_2857 glucose-6-phosphate isomerase;
FT                   PFAM: phosphoglucose isomerase (PGI)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73394"
FT                   /db_xref="GOA:A0A0F6BIZ3"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ3"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ADP73394.1"
FT                   /translation="MTHIRFDYSKALAFFGEHELTYLRDAVKVAHHSLHEKTGVGNDFL
FT                   GWIDLPVNYDKEEFARIQKAAAKIQADSDVLLVIGIGGSYLGARAAIEMLHHSFYNALS
FT                   KEKRRTPQIIFVGNNISSTYMKDVMDLLEGKDFSINVISKSGTTTEPAIAFRIFRKLLE
FT                   EKYGKEEARKRIYATTDRARGALKTLATAEGYETFIIPDDVGGRYSVLTAVGLLPIAVS
FT                   GANIEEMMKGAAQAREDFSNSELEENAAYQYAAIRNILYNKGKTIELLINYEPALQYFA
FT                   EWWKQLFGESEGKDQKGIFPASANFSTDLHSLGQYIQEGRRDLFETVLKVEKPRHELVI
FT                   EAEENDLDGLNYLAGKTVDFVNTKAFEGTLLAHTDGGVPNLVITLPELNEYTFGYLVYF
FT                   FEKACAMSGYLLGVNPFDQPGVEAYKVNMFALLGKPGYEEKKAELEKRLK"
     MTHIRFDYSK ALAFFGEHEL TYLRDAVKVA HHSLHEKTGV GNDFLGWIDL PVNYDKEEFA        60
     RIQKAAAKIQ ADSDVLLVIG IGGSYLGARA AIEMLHHSFY NALSKEKRRT PQIIFVGNNI       120
     SSTYMKDVMD LLEGKDFSIN VISKSGTTTE PAIAFRIFRK LLEEKYGKEE ARKRIYATTD       180
     RARGALKTLA TAEGYETFII PDDVGGRYSV LTAVGLLPIA VSGANIEEMM KGAAQAREDF       240
     SNSELEENAA YQYAAIRNIL YNKGKTIELL INYEPALQYF AEWWKQLFGE SEGKDQKGIF       300
     PASANFSTDL HSLGQYIQEG RRDLFETVLK VEKPRHELVI EAEENDLDGL NYLAGKTVDF       360
     VNTKAFEGTL LAHTDGGVPN LVITLPELNE YTFGYLVYFF EKACAMSGYL LGVNPFDQPG       420
     VEAYKVNMFA LLGKPGYEEK KAELEKRLK                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page