(data stored in ACNUC7421 zone)

EMBL: CP002293.PE54

CP002293.PE54        Location/Qualifiers
FT   CDS             66146..67609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0054"
FT                   /product="MazG family protein"
FT                   /note="KEGG: gwc:GWCH70_0053 MazG family protein; TIGRFAM:
FT                   MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72910"
FT                   /db_xref="GOA:A0A0F6BHK9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHK9"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ADP72910.1"
FT                   /translation="MNTIYVFGLGAGDIEQLPLGVYRKLKTASPLFLRTKEHPVVHALQ
FT                   AEGVSFTSFDAIYEKHERFEDVYEEMAAILLEQAQKNDVFYAVPGHPLVAEKTVQLLLE
FT                   AERRKQCRVVIEGGQSFLDALFTTLKIDPIEGFQLIDATSFQGDEWQLTNHTIFCQVYD
FT                   SFIASEVKLTLMEQLPDDYPVYIVTAAGSKEEKVMEVPLYELDRATVLNNLTSVYVPPV
FT                   REETMLYHRFETLRRVIATLRGPNGCPWDRKQTHESLKRYLLEETYELFEAIDENDDEH
FT                   MVEELGDVLLQVMLHAQIGEDEGMFSIDDVIRGITEKMIRRHPHVFGDVTVENAEQVVE
FT                   NWQRIKEKEKQDRADSLLDDVPKSLPNILRAYEFQKKAAKVGFDWDDVKPMWEKVEEEM
FT                   AEFKREALGEKTVRSRLISEFGDILFALINVARYYGINPEEALHATNQKFYRRFSYIEE
FT                   QARKNGVALTSLSLAELDRFWEEAKEKGW"
     MNTIYVFGLG AGDIEQLPLG VYRKLKTASP LFLRTKEHPV VHALQAEGVS FTSFDAIYEK        60
     HERFEDVYEE MAAILLEQAQ KNDVFYAVPG HPLVAEKTVQ LLLEAERRKQ CRVVIEGGQS       120
     FLDALFTTLK IDPIEGFQLI DATSFQGDEW QLTNHTIFCQ VYDSFIASEV KLTLMEQLPD       180
     DYPVYIVTAA GSKEEKVMEV PLYELDRATV LNNLTSVYVP PVREETMLYH RFETLRRVIA       240
     TLRGPNGCPW DRKQTHESLK RYLLEETYEL FEAIDENDDE HMVEELGDVL LQVMLHAQIG       300
     EDEGMFSIDD VIRGITEKMI RRHPHVFGDV TVENAEQVVE NWQRIKEKEK QDRADSLLDD       360
     VPKSLPNILR AYEFQKKAAK VGFDWDDVKP MWEKVEEEMA EFKREALGEK TVRSRLISEF       420
     GDILFALINV ARYYGINPEE ALHATNQKFY RRFSYIEEQA RKNGVALTSL SLAELDRFWE       480
     EAKEKGW                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page