(data stored in ACNUC7421 zone)

EMBL: CP002293.PE541

CP002293.PE541       Location/Qualifiers
FT   CDS             complement(592608..593603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0565"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   Ion transport 2 domain protein; KEGG: gwc:GWCH70_2854
FT                   TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73397"
FT                   /db_xref="GOA:A0A0F6BIZ6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ6"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADP73397.1"
FT                   /translation="MKNWDVFISYLRLPVFMRLLIIGTIMIVIFGTLIHFVEPATFRHV
FT                   FDGIWWAIVTAATIGYGDMVPKTVAGKIVAISLILLGTGVITTYFASLSAAAVAKESAL
FT                   SNGQLRYMQKGHIIIVGWNERAREVIAKLSEYTPPVRCVIIDATLNELPVPFKNVHFIK
FT                   GNPSYDDVLHKANATEAQMILITANQHKSEADADKDSILTLLAVKGIHPSIYAIVEILT
FT                   EQNVNNAKRAGADEVIQTNLLASFTMANSLQSPGVSKAIIELLHQLHGKKLQLIAAEGP
FT                   LIGKTFLESSEMLLDKRMILIGVMREEEGYINPSPHFLIEKGDRLFVITP"
     MKNWDVFISY LRLPVFMRLL IIGTIMIVIF GTLIHFVEPA TFRHVFDGIW WAIVTAATIG        60
     YGDMVPKTVA GKIVAISLIL LGTGVITTYF ASLSAAAVAK ESALSNGQLR YMQKGHIIIV       120
     GWNERAREVI AKLSEYTPPV RCVIIDATLN ELPVPFKNVH FIKGNPSYDD VLHKANATEA       180
     QMILITANQH KSEADADKDS ILTLLAVKGI HPSIYAIVEI LTEQNVNNAK RAGADEVIQT       240
     NLLASFTMAN SLQSPGVSKA IIELLHQLHG KKLQLIAAEG PLIGKTFLES SEMLLDKRMI       300
     LIGVMREEEG YINPSPHFLI EKGDRLFVIT P                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page