(data stored in SCRATCH zone)

EMBL: CP002293.PE542

CP002293.PE542       Location/Qualifiers
FT   CDS             593731..593916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0566"
FT                   /product="small acid-soluble spore protein, H-type"
FT                   /note="KEGG: gwc:GWCH70_2853 small acid-soluble spore
FT                   protein, H-type; TIGRFAM: small acid-soluble spore protein,
FT                   H-type; PFAM: small acid-soluble spore H family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73398"
FT                   /db_xref="GOA:A0A0F6BIZ7"
FT                   /db_xref="InterPro:IPR012610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BIZ7"
FT                   /inference="protein motif:TFAM:TIGR02861"
FT                   /protein_id="ADP73398.1"
FT                   /translation="MDINRVKQIVSSPADIPVYYNGVSVWIDDYNEQEETATIHLRDGH
FT                   LREQREVPVEELTEKQ"
     MDINRVKQIV SSPADIPVYY NGVSVWIDDY NEQEETATIH LRDGHLREQR EVPVEELTEK        60
     Q                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page