(data stored in SCRATCH zone)

EMBL: CP002293.PE545

CP002293.PE545       Location/Qualifiers
FT   CDS             596758..597246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0569"
FT                   /product="Phosphinothricin acetyltransferase"
FT                   /note="KEGG: gwc:GWCH70_2852 GCN5-related
FT                   N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73401"
FT                   /db_xref="GOA:A0A0F6BJ00"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ00"
FT                   /inference="protein motif:PRIAM:2.3.1.183"
FT                   /protein_id="ADP73401.1"
FT                   /translation="MIRNANIEDLPAIVQIYNETIPSRMVTADLEPVTVESRKAWFFNH
FT                   DPHTRPLWVVELDGHVRAWLSFQSFYGRPAYRHTAEISIYISGAYRGKGIGKQLLQKAV
FT                   EEAPSLDIKTLLGFIFAHNEPSLRLFMRFGFETWGHLPKVAELDGIERDLLIVGKRMV"
     MIRNANIEDL PAIVQIYNET IPSRMVTADL EPVTVESRKA WFFNHDPHTR PLWVVELDGH        60
     VRAWLSFQSF YGRPAYRHTA EISIYISGAY RGKGIGKQLL QKAVEEAPSL DIKTLLGFIF       120
     AHNEPSLRLF MRFGFETWGH LPKVAELDGI ERDLLIVGKR MV                          162
//

If you have problems or comments...

PBIL Back to PBIL home page