(data stored in SCRATCH zone)

EMBL: CP002293.PE546

CP002293.PE546       Location/Qualifiers
FT   CDS             597307..597564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0570"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gwc:GWCH70_2851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ01"
FT                   /inference="similar to AA sequence:KEGG:GWCH70_2851"
FT                   /protein_id="ADP73402.1"
FT                   /translation="MNVMPIRLFTIQDGEGFVADAFQCPVTGNLIYKSSGTPSVIAYNA
FT                   LTEEQIQYLEKYGFRRMNGASAAAASSPGSSTLEELLPEQ"
     MNVMPIRLFT IQDGEGFVAD AFQCPVTGNL IYKSSGTPSV IAYNALTEEQ IQYLEKYGFR        60
     RMNGASAAAA SSPGSSTLEE LLPEQ                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page