(data stored in SCRATCH zone)

EMBL: CP002293.PE547

CP002293.PE547       Location/Qualifiers
FT   CDS             complement(597685..598626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0571"
FT                   /product="nuclease (SNase domain-containing protein)"
FT                   /note="KEGG: gwc:GWCH70_2850 nuclease (SNase domain
FT                   protein); PFAM: nuclease (SNase domain-containing protein);
FT                   SMART: nuclease (SNase domain-containing protein)"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73403"
FT                   /db_xref="GOA:A0A0F6BJ02"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ02"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADP73403.1"
FT                   /translation="MKKFVSALAIIVSTAIFPGNSFAHPGALDKLGGHFRKSDCTYLLH
FT                   EPTPIAMQAKDKAALAQLIKKYNSNSECVRQLTLDKIDLQGHTLGGTSSSAASSPKQST
FT                   NQSSSLQLGQKYPAKLVTCIDGDTARFMVNGREYTTRFLFIDTPESTIQVEPYGKEASR
FT                   FTCSRLSRGDITLETDGSTLFDKYRRLLAWVWVGDKLLQEEIAKAGLVEDFYDYGDYKY
FT                   EDRIRKAMDEAKQAGAGMYGASSPKMNSADQQTKSEGQKPDIPSPDNEQKNQQADQETT
FT                   AKETSDSNTELPVFYLLVFAFIVAFFYFLSRK"
     MKKFVSALAI IVSTAIFPGN SFAHPGALDK LGGHFRKSDC TYLLHEPTPI AMQAKDKAAL        60
     AQLIKKYNSN SECVRQLTLD KIDLQGHTLG GTSSSAASSP KQSTNQSSSL QLGQKYPAKL       120
     VTCIDGDTAR FMVNGREYTT RFLFIDTPES TIQVEPYGKE ASRFTCSRLS RGDITLETDG       180
     STLFDKYRRL LAWVWVGDKL LQEEIAKAGL VEDFYDYGDY KYEDRIRKAM DEAKQAGAGM       240
     YGASSPKMNS ADQQTKSEGQ KPDIPSPDNE QKNQQADQET TAKETSDSNT ELPVFYLLVF       300
     AFIVAFFYFL SRK                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page