(data stored in ACNUC7421 zone)

EMBL: CP002293.PE550

CP002293.PE550       Location/Qualifiers
FT   CDS             complement(602248..603120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0574"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bld:BLi00758 YfmS; PFAM: chemotaxis sensory
FT                   transducer; SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73406"
FT                   /db_xref="GOA:A0A0F6BJ05"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ05"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADP73406.1"
FT                   /translation="MEKVEEKEKTNVEDIELLDAFLKVAPYLNQLVHEDITVGIYDTEK
FT                   LIVNYPAKTFSLNVKPGDPLQEGDIITNAIKQNKLLSAIVPKELFGVGLIAKAMPIHDR
FT                   NGRVVGGIGIGVNMEKAMQLSEISSNLSTVMEEITATIQSMADSITELSNEITTISEKA
FT                   KEAAENVGKIEGISNLVKEIADQSNLLGLNAAIEAARAGEHGKGFSIVANEVRKMANTS
FT                   KQHVEEINEKTNQMKNLIKQLNDFIQSVSEESSAQSAAIEELSATMQEINTNIQVLAEI
FT                   AKQNIEIEK"
     MEKVEEKEKT NVEDIELLDA FLKVAPYLNQ LVHEDITVGI YDTEKLIVNY PAKTFSLNVK        60
     PGDPLQEGDI ITNAIKQNKL LSAIVPKELF GVGLIAKAMP IHDRNGRVVG GIGIGVNMEK       120
     AMQLSEISSN LSTVMEEITA TIQSMADSIT ELSNEITTIS EKAKEAAENV GKIEGISNLV       180
     KEIADQSNLL GLNAAIEAAR AGEHGKGFSI VANEVRKMAN TSKQHVEEIN EKTNQMKNLI       240
     KQLNDFIQSV SEESSAQSAA IEELSATMQE INTNIQVLAE IAKQNIEIEK                  290
//

If you have problems or comments...

PBIL Back to PBIL home page