(data stored in SCRATCH zone)

EMBL: CP002293.PE552

CP002293.PE552       Location/Qualifiers
FT   CDS             606529..607299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0577"
FT                   /product="Threonyl/alanyl tRNA synthetase SAD"
FT                   /note="PFAM: Threonyl/alanyl tRNA synthetase SAD;
FT                   Alanyl-tRNA synthetase, class IIc-like; KEGG:
FT                   bcy:Bcer98_0478 threonyl/alanyl tRNA synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73408"
FT                   /db_xref="GOA:A0A0F6BJ07"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ07"
FT                   /inference="protein motif:PFAM:PF07973"
FT                   /protein_id="ADP73408.1"
FT                   /translation="MTRELFLEDSYKKAHHAKVIEIKEDKIILDETIFYPTGGGQPHDT
FT                   GMIKQGNETFKVNKVQRENGQIVHYVDNIEKLKQGPVEILIDWDRRYKFMRYHSLLHVL
FT                   AGYLYNKFGALAIGNQIFEDRARIDFQFEEPLTNEQFNEIEDEINKLIQEDHQVSIRTV
FT                   SREEAERIDGSIKTVINLLPPSIKNVRLVAIGDIDEQACGGTHVKETKEIGPFQISKIK
FT                   SKGQNKKRLEVKSKLLCKFPFDRKHGPDDLTYGR"
     MTRELFLEDS YKKAHHAKVI EIKEDKIILD ETIFYPTGGG QPHDTGMIKQ GNETFKVNKV        60
     QRENGQIVHY VDNIEKLKQG PVEILIDWDR RYKFMRYHSL LHVLAGYLYN KFGALAIGNQ       120
     IFEDRARIDF QFEEPLTNEQ FNEIEDEINK LIQEDHQVSI RTVSREEAER IDGSIKTVIN       180
     LLPPSIKNVR LVAIGDIDEQ ACGGTHVKET KEIGPFQISK IKSKGQNKKR LEVKSKLLCK       240
     FPFDRKHGPD DLTYGR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page