(data stored in ACNUC7421 zone)

EMBL: CP002293.PE555

CP002293.PE555       Location/Qualifiers
FT   CDS             complement(610196..611395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0581"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: gtn:GTNG_0752
FT                   DNA integration/recombination/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73411"
FT                   /db_xref="GOA:A0A0F6BJ10"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ10"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP73411.1"
FT                   /translation="MASIQRRGKSSFLLVVEAGYDAKGKRLRRTKTIRIEDEALLKTTK
FT                   KLRDYLNEELLKFKMEVEAGEYIAPEKMKLADFIKEWETKYAVKELSETTLNNYLSHIK
FT                   NHILPALGHMRIDQIKPVHIVNFLDQIKRADGKKKPLATRTIENAYLTIRNILQRAVEW
FT                   QIIKSNPASAVKKPKSKKEAVKEVQVYDEKEVEALFRAVQNEPFHWRIFTTLAIAAGLR
FT                   RGELLALEWSNIDLEKGVIRINKAIVKGRKRSVEKSPKTKKSNRLVSLPKSVVAELKLY
FT                   RRHWLKQKLQAGDLWKEEKEYLFCNIDGRHFYPTTPTTWWRRFTKRAGIRYIRLHDLRH
FT                   TSATLLINQGVHAKIIAERLGHSDIRVTMDIYGHALQKADHEAANKLDHLFTNTSSQMK
FT                   "
     MASIQRRGKS SFLLVVEAGY DAKGKRLRRT KTIRIEDEAL LKTTKKLRDY LNEELLKFKM        60
     EVEAGEYIAP EKMKLADFIK EWETKYAVKE LSETTLNNYL SHIKNHILPA LGHMRIDQIK       120
     PVHIVNFLDQ IKRADGKKKP LATRTIENAY LTIRNILQRA VEWQIIKSNP ASAVKKPKSK       180
     KEAVKEVQVY DEKEVEALFR AVQNEPFHWR IFTTLAIAAG LRRGELLALE WSNIDLEKGV       240
     IRINKAIVKG RKRSVEKSPK TKKSNRLVSL PKSVVAELKL YRRHWLKQKL QAGDLWKEEK       300
     EYLFCNIDGR HFYPTTPTTW WRRFTKRAGI RYIRLHDLRH TSATLLINQG VHAKIIAERL       360
     GHSDIRVTMD IYGHALQKAD HEAANKLDHL FTNTSSQMK                              399
//

If you have problems or comments...

PBIL Back to PBIL home page