(data stored in ACNUC7421 zone)

EMBL: CP002293.PE557

CP002293.PE557       Location/Qualifiers
FT   CDS             complement(611663..612178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0583"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   bbe:BBR47_35830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73413"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ12"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADP73413.1"
FT                   /translation="MELHRYYTTALEDWVTRFYTRLKIFRPEDISPLIISRKLGIFLRE
FT                   RPFPSTHQVVGRFRCIVVDSRLSKEKKREAFFHELCHILRHVGIQSMMPEAFRELQERD
FT                   ATHFTKYAAIPFHMLKLIDWHEPYIVEHMSNMFKVTPELCEERLTQIRNRILVKQSSNE
FT                   TKISTFQR"
     MELHRYYTTA LEDWVTRFYT RLKIFRPEDI SPLIISRKLG IFLRERPFPS THQVVGRFRC        60
     IVVDSRLSKE KKREAFFHEL CHILRHVGIQ SMMPEAFREL QERDATHFTK YAAIPFHMLK       120
     LIDWHEPYIV EHMSNMFKVT PELCEERLTQ IRNRILVKQS SNETKISTFQ R                171
//

If you have problems or comments...

PBIL Back to PBIL home page