(data stored in ACNUC7421 zone)

EMBL: CP002293.PE558

CP002293.PE558       Location/Qualifiers
FT   CDS             complement(612280..613173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0584"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; KEGG: cpf:CPF_1606 putative
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73414"
FT                   /db_xref="GOA:A0A0F6BJ13"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ13"
FT                   /inference="protein motif:PFAM:PF02086"
FT                   /protein_id="ADP73414.1"
FT                   /translation="MIVMGVIIIPVTDSPLRYPGGKTQLKGFINELIQTNSIKDCTYVE
FT                   PFAGGAGVAMSLLLTEKVQEVIINDIDSSIYCFWKSILEHTDNFIKLLEETPVNINEWY
FT                   KQKYIQENKDKFSVLEIGFSTFFLNRTNRSGIITGGPIGGYSQHSQYKIDCRFNKKNLI
FT                   KKILKIASYKKQITVTNDDASVFIDKVIKFLDKDKTFIFFDPPYYKQGKHLYTNFYTHD
FT                   DHVHLSKKILSLKDYYWITTYDLSKEIMEIYNIKNQKIYRLNYSANNKRKAAELLFYSE
FT                   RTTLPETNHIELISNI"
     MIVMGVIIIP VTDSPLRYPG GKTQLKGFIN ELIQTNSIKD CTYVEPFAGG AGVAMSLLLT        60
     EKVQEVIIND IDSSIYCFWK SILEHTDNFI KLLEETPVNI NEWYKQKYIQ ENKDKFSVLE       120
     IGFSTFFLNR TNRSGIITGG PIGGYSQHSQ YKIDCRFNKK NLIKKILKIA SYKKQITVTN       180
     DDASVFIDKV IKFLDKDKTF IFFDPPYYKQ GKHLYTNFYT HDDHVHLSKK ILSLKDYYWI       240
     TTYDLSKEIM EIYNIKNQKI YRLNYSANNK RKAAELLFYS ERTTLPETNH IELISNI          297
//

If you have problems or comments...

PBIL Back to PBIL home page