(data stored in SCRATCH zone)

EMBL: CP002293.PE561

CP002293.PE561       Location/Qualifiers
FT   CDS             complement(617995..618441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0589"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: cth:Cthe_2460 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADP73417"
FT                   /db_xref="GOA:A0A0F6BJ16"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BJ16"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP73417.1"
FT                   /translation="MNILGKRLKYLREKFNYSQKKVAEAIGISNVQLSRYESGDRNPDP
FT                   ELIAAFADFYGVTTDYILGRTDDPQGYAPETNIDNIKDTKELNTLIKINELIKKYGIEQ
FT                   MGFFDIEKWKSLSEEEIEEIIKHFEWVVHKAKEKNKAAREGTED"
     MNILGKRLKY LREKFNYSQK KVAEAIGISN VQLSRYESGD RNPDPELIAA FADFYGVTTD        60
     YILGRTDDPQ GYAPETNIDN IKDTKELNTL IKINELIKKY GIEQMGFFDI EKWKSLSEEE       120
     IEEIIKHFEW VVHKAKEKNK AAREGTED                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page