(data stored in ACNUC7421 zone)

EMBL: CP002293.PE58

CP002293.PE58        Location/Qualifiers
FT   CDS             68944..69351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0058"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG:
FT                   gwc:GWCH70_0057 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72914"
FT                   /db_xref="GOA:A0A0F6BHL3"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL3"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADP72914.1"
FT                   /translation="MNVPHRTNVTKLQSSYISAQEEKRTKASKRRKIAIVRFAFFGILL
FT                   AALSSIFFYTLHSQSQDIEAKLADKKRMEQQLDKLEKQQKQLEEEIKKLHDDEYIAELA
FT                   RKKYYLSKEGEIIFVVPEKNSPPYDAGKFGH"
     MNVPHRTNVT KLQSSYISAQ EEKRTKASKR RKIAIVRFAF FGILLAALSS IFFYTLHSQS        60
     QDIEAKLADK KRMEQQLDKL EKQQKQLEEE IKKLHDDEYI AELARKKYYL SKEGEIIFVV       120
     PEKNSPPYDA GKFGH                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page