(data stored in ACNUC7421 zone)

EMBL: CP002293.PE6

CP002293.PE6         Location/Qualifiers
FT   CDS             6577..9051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: gwc:GWCH70_0006 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72862"
FT                   /db_xref="GOA:A0A0F6BHG1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG1"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADP72862.1"
FT                   /translation="MSENQHPRIREVNISQEMRSSFLDYAMSVIVSRALPDVRDGLKPV
FT                   HRRILYAMHDLGMTADKPYKKSARIVGEVIGKYHPHGDAAVYDTMVRMAQDFNYRYMLV
FT                   DGHGNFGSIDGDAAAAMRYTEARMSKIAMEMLRDINKDTIDYQDNYDGSEKEPVVLPSR
FT                   FPNLLVNGSSGIAVGMATNIPPHQLGEVIDAILALSKNPDMTVADLMEHIPGPDFPTAG
FT                   QIIGRSGIRKAYETGRGSITLRAKAEIEQQPNGKEMIIVRELPYQVNKAKLIERIAELV
FT                   REKKIDGITDLRDESDRSGMRIVIEVRKDANAKVILNNLYKHTAMQTSFGINMLALVDG
FT                   QPKVLNLKECLQHYLDHQKTVIRRRTAYELKKAEARAHILEGLRIALDYLDEVINLIRS
FT                   SKTTEIAREGLMQQFSLSERQAQAILDMRLQRLTGLEREKIEQEYQELIRLIAELKAIL
FT                   ADEEKVLQIIRDELTEIKERFNDERRTEIVAGGAEEFEDEDLIPRENIVITLTHKGYIK
FT                   RLPVSTYKSQKRGGRGVQGMHTNEDDFVEHLLITSTHDTVLFFTNKGKVYRAKGYEIPE
FT                   FGRTAKGIPLINLLELDKDEWINTIIPIDNEFDDNLYLFFTTKQGIAKRSPLSSFAHIR
FT                   NNGLIAIHLREGDELISAKLTDGSKHIIVGTKNGMLIRFPETDVRAMGRSATGVKAITL
FT                   EDGDEVVGMEILEDGCDVLVVTKNGYGKRTPASEYRIQSRGGKGIKTCNITEKNGPIVA
FT                   VKTVTGEEDLMLITASGILIRIAVSDISRMGRNTQGVKLIRLSDDNEHEYVATVAKVPK
FT                   EEKENEAEEEEH"
     MSENQHPRIR EVNISQEMRS SFLDYAMSVI VSRALPDVRD GLKPVHRRIL YAMHDLGMTA        60
     DKPYKKSARI VGEVIGKYHP HGDAAVYDTM VRMAQDFNYR YMLVDGHGNF GSIDGDAAAA       120
     MRYTEARMSK IAMEMLRDIN KDTIDYQDNY DGSEKEPVVL PSRFPNLLVN GSSGIAVGMA       180
     TNIPPHQLGE VIDAILALSK NPDMTVADLM EHIPGPDFPT AGQIIGRSGI RKAYETGRGS       240
     ITLRAKAEIE QQPNGKEMII VRELPYQVNK AKLIERIAEL VREKKIDGIT DLRDESDRSG       300
     MRIVIEVRKD ANAKVILNNL YKHTAMQTSF GINMLALVDG QPKVLNLKEC LQHYLDHQKT       360
     VIRRRTAYEL KKAEARAHIL EGLRIALDYL DEVINLIRSS KTTEIAREGL MQQFSLSERQ       420
     AQAILDMRLQ RLTGLEREKI EQEYQELIRL IAELKAILAD EEKVLQIIRD ELTEIKERFN       480
     DERRTEIVAG GAEEFEDEDL IPRENIVITL THKGYIKRLP VSTYKSQKRG GRGVQGMHTN       540
     EDDFVEHLLI TSTHDTVLFF TNKGKVYRAK GYEIPEFGRT AKGIPLINLL ELDKDEWINT       600
     IIPIDNEFDD NLYLFFTTKQ GIAKRSPLSS FAHIRNNGLI AIHLREGDEL ISAKLTDGSK       660
     HIIVGTKNGM LIRFPETDVR AMGRSATGVK AITLEDGDEV VGMEILEDGC DVLVVTKNGY       720
     GKRTPASEYR IQSRGGKGIK TCNITEKNGP IVAVKTVTGE EDLMLITASG ILIRIAVSDI       780
     SRMGRNTQGV KLIRLSDDNE HEYVATVAKV PKEEKENEAE EEEH                        824
//

If you have problems or comments...

PBIL Back to PBIL home page