(data stored in ACNUC7421 zone)

EMBL: CP002293.PE61

CP002293.PE61        Location/Qualifiers
FT   CDS             72332..74809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0061"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="SMART: protein phosphatase 2C domain protein;
FT                   TIGRFAM: stage II sporulation protein E; KEGG:
FT                   gwc:GWCH70_0059 stage II sporulation protein E, protein
FT                   serine/threonine phosphatase; PFAM: Stage II sporulation
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72917"
FT                   /db_xref="GOA:A0A0F6BHL6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL6"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ADP72917.1"
FT                   /translation="MERVEKRWMNRISEMSINETQAVLSRWVRHVKLRIGHLFIHKGFL
FT                   LFIIGFLLGRALILSKLTPFALPFFAAVYMLRRDKAALAFVALLAGSLTLSLTTTLFIF
FT                   IGIFSFLIVNAFLRKFFSESIKIVPLIIFCLSFFAKLAILRYFLKNETLYEAVMAFVEA
FT                   GLAFVLTLIFIQSIPLLAVRKHKQALRAEEIISLIILIASMLTGMIGWTFYGLSLEHVM
FT                   SRYLVLIFALVAGATIGPTVGVVTGLILSLANVGNLYEMSLLAFAGLLGGLLKEGKKAG
FT                   ASFGLLVATLLIGLYGNGKAEIVPTVMESCLAIILFICTPRSLTETIAKHIPGTVEYAN
FT                   EQQQYARKIRDVTAQRVSQFSHVFQALANSFSTDSFTSSEDYNEREIDYFLSDIAGKTC
FT                   QTCFKKEQCWSAHFDTTYEYMKKIMLEADAGKLEHNRKLLREWDRHCVKANKVVGMIEK
FT                   DVTLYRANRKVRKQMNESRKMVAEQLLGVSQVMEDFAKEIQRERENHYLQEEQIFHALQ
FT                   EFGIEIGHIDIYSLEKGNIDIEMSVPYCEGRGECEKLIAPMLSDILGETIVVKREECAV
FT                   YPNGYCRVAFGSARAFVVETGVAFAAKGGGLVSGDSYSMIELGTGKYAIAISDGMGNGE
FT                   RAHHESNETLRLLQKILQTGMDESIAIKSVNSILSLRTTEDMFSTLDLAMIDLQNAVTK
FT                   FLKIGSAPSFIKRGDKVMKIEASNLPIGIIKEVEFEIVSEQLKAGDLLIMMSDGVFEGP
FT                   PHVENHDLWMKRKIKELKTNDPQAVADLIMEEVIRSRSGRIEDDMTVVVAKINHNTPKW
FT                   ATIPAYMYTKKAQ"
     MERVEKRWMN RISEMSINET QAVLSRWVRH VKLRIGHLFI HKGFLLFIIG FLLGRALILS        60
     KLTPFALPFF AAVYMLRRDK AALAFVALLA GSLTLSLTTT LFIFIGIFSF LIVNAFLRKF       120
     FSESIKIVPL IIFCLSFFAK LAILRYFLKN ETLYEAVMAF VEAGLAFVLT LIFIQSIPLL       180
     AVRKHKQALR AEEIISLIIL IASMLTGMIG WTFYGLSLEH VMSRYLVLIF ALVAGATIGP       240
     TVGVVTGLIL SLANVGNLYE MSLLAFAGLL GGLLKEGKKA GASFGLLVAT LLIGLYGNGK       300
     AEIVPTVMES CLAIILFICT PRSLTETIAK HIPGTVEYAN EQQQYARKIR DVTAQRVSQF       360
     SHVFQALANS FSTDSFTSSE DYNEREIDYF LSDIAGKTCQ TCFKKEQCWS AHFDTTYEYM       420
     KKIMLEADAG KLEHNRKLLR EWDRHCVKAN KVVGMIEKDV TLYRANRKVR KQMNESRKMV       480
     AEQLLGVSQV MEDFAKEIQR ERENHYLQEE QIFHALQEFG IEIGHIDIYS LEKGNIDIEM       540
     SVPYCEGRGE CEKLIAPMLS DILGETIVVK REECAVYPNG YCRVAFGSAR AFVVETGVAF       600
     AAKGGGLVSG DSYSMIELGT GKYAIAISDG MGNGERAHHE SNETLRLLQK ILQTGMDESI       660
     AIKSVNSILS LRTTEDMFST LDLAMIDLQN AVTKFLKIGS APSFIKRGDK VMKIEASNLP       720
     IGIIKEVEFE IVSEQLKAGD LLIMMSDGVF EGPPHVENHD LWMKRKIKEL KTNDPQAVAD       780
     LIMEEVIRSR SGRIEDDMTV VVAKINHNTP KWATIPAYMY TKKAQ                       825
//

If you have problems or comments...

PBIL Back to PBIL home page