(data stored in ACNUC7421 zone)

EMBL: CP002293.PE62

CP002293.PE62        Location/Qualifiers
FT   CDS             74872..75606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0062"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   gwc:GWCH70_0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72918"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL7"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADP72918.1"
FT                   /translation="MSRGTLRQILLITDGCSNHGEDPIAMAALAKEQGITVNVIGVLDQ
FT                   DTIDESGLREIEGIALSGGGISQVVYAKQLSQTVQMVTRKAMTQTLQGVVNKELKQILG
FT                   SDVSLENLPPEKRGEVMEVVDELGETVELEVLILIDTSGSMKTKLPTVKEALLDLSLSL
FT                   NARIGDNRFAVFVFPGKRGNVEKIVDWTPEIEELSTVFPKLTSGGLTPTGPALREALTY
FT                   FERKRSLRSLIRDDESYFEGSM"
     MSRGTLRQIL LITDGCSNHG EDPIAMAALA KEQGITVNVI GVLDQDTIDE SGLREIEGIA        60
     LSGGGISQVV YAKQLSQTVQ MVTRKAMTQT LQGVVNKELK QILGSDVSLE NLPPEKRGEV       120
     MEVVDELGET VELEVLILID TSGSMKTKLP TVKEALLDLS LSLNARIGDN RFAVFVFPGK       180
     RGNVEKIVDW TPEIEELSTV FPKLTSGGLT PTGPALREAL TYFERKRSLR SLIRDDESYF       240
     EGSM                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page