(data stored in ACNUC7421 zone)

EMBL: CP002293.PE63

CP002293.PE63        Location/Qualifiers
FT   CDS             75575..76552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0063"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: gwc:GWCH70_0061 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72919"
FT                   /db_xref="GOA:A0A0F6BHL8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHL8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP72919.1"
FT                   /translation="MMNHTLKGLCNLPAGTVITGKWHHQSYKLLKPLGHGANGAVYLAE
FT                   SAKGIVALKLSDNSEAVTSEVNVLRRFSKVQGVALGPSLLDVDDWAAPLMKKHISFYVM
FT                   EYIRGEDFSTFIRKHGKEWVAILLLQLLSVLDKLHQEGWVFGDLKPENLLITGPPPTVR
FT                   LLDVGGTTLQGRAVKEFTELYDRGYWGVGSRKAEPSYDLFAVAIIMIQSCCPIKLERKG
FT                   DGRRQLISIIQADVMLRKYQTVLMKAIDGKYKRASEMKQDLLAAIGRPDHSHSKQRASQ
FT                   KTVQKSRRSKQRKRGKARGVLETALIIAVLLCAYAVYVYHQVLP"
     MMNHTLKGLC NLPAGTVITG KWHHQSYKLL KPLGHGANGA VYLAESAKGI VALKLSDNSE        60
     AVTSEVNVLR RFSKVQGVAL GPSLLDVDDW AAPLMKKHIS FYVMEYIRGE DFSTFIRKHG       120
     KEWVAILLLQ LLSVLDKLHQ EGWVFGDLKP ENLLITGPPP TVRLLDVGGT TLQGRAVKEF       180
     TELYDRGYWG VGSRKAEPSY DLFAVAIIMI QSCCPIKLER KGDGRRQLIS IIQADVMLRK       240
     YQTVLMKAID GKYKRASEMK QDLLAAIGRP DHSHSKQRAS QKTVQKSRRS KQRKRGKARG       300
     VLETALIIAV LLCAYAVYVY HQVLP                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page