(data stored in ACNUC7421 zone)

EMBL: CP002293.PE65

CP002293.PE65        Location/Qualifiers
FT   CDS             78080..78625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0065"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: gwc:GWCH70_0063 hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72921"
FT                   /db_xref="GOA:A0A0F6BHM0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM0"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADP72921.1"
FT                   /translation="MGMKDDIQKILITEQQIQEKVKELGKLLTEEYEGRFPLAVGVLKG
FT                   AMPFMADLLKHIDTYLEMDFMDVSSYGNATVSSGEVKILKDLNTSVEGRDILIIEDIID
FT                   SGLTLSYLVDLFRYRKANSIKIVTLLDKPSGRKANIQADYTGFIVPDEFVVGYGLDYCE
FT                   KYRNLPYIGVLKPEVYNK"
     MGMKDDIQKI LITEQQIQEK VKELGKLLTE EYEGRFPLAV GVLKGAMPFM ADLLKHIDTY        60
     LEMDFMDVSS YGNATVSSGE VKILKDLNTS VEGRDILIIE DIIDSGLTLS YLVDLFRYRK       120
     ANSIKIVTLL DKPSGRKANI QADYTGFIVP DEFVVGYGLD YCEKYRNLPY IGVLKPEVYN       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page