(data stored in SCRATCH zone)

EMBL: CP002293.PE67

CP002293.PE67        Location/Qualifiers
FT   CDS             80721..81494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0067"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   KEGG: gwc:GWCH70_0065 putative transcriptional acitvator,
FT                   Baf family; PFAM: Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72923"
FT                   /db_xref="GOA:A0A0F6BHM2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM2"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADP72923.1"
FT                   /translation="MIFVLDVGNTNTVLGVYDGDELKHHWRIETSRGKTEDEYGMLIKA
FT                   LLNHVGLQFSDIDGIIISSVVPPIMFALERMCLKYFHIKPIIVGPGIKTGLDIKYDNPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEHKQYMGGAIAPGIMISTEALFA
FT                   RAAKLPRIEIARPDDIIGKNTVSAMQAGILYGYVGQVEGIVARMKAKSPVPPKVIATGG
FT                   LASLIASESDVIDIVDPFLTLTGLKILYEKNVDKK"
     MIFVLDVGNT NTVLGVYDGD ELKHHWRIET SRGKTEDEYG MLIKALLNHV GLQFSDIDGI        60
     IISSVVPPIM FALERMCLKY FHIKPIIVGP GIKTGLDIKY DNPREVGADR IVNAVAGIHL       120
     YGSPLIIVDF GTATTYCYIN EHKQYMGGAI APGIMISTEA LFARAAKLPR IEIARPDDII       180
     GKNTVSAMQA GILYGYVGQV EGIVARMKAK SPVPPKVIAT GGLASLIASE SDVIDIVDPF       240
     LTLTGLKILY EKNVDKK                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page