(data stored in SCRATCH zone)

EMBL: CP002293.PE69

CP002293.PE69        Location/Qualifiers
FT   CDS             82498..83424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0069"
FT                   /product="cysteine synthase"
FT                   /note="KEGG: gwc:GWCH70_0067 cysteine synthase A; TIGRFAM:
FT                   cysteine synthase; cysteine synthase A; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72925"
FT                   /db_xref="GOA:A0A0F6BHM4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM4"
FT                   /inference="protein motif:TFAM:TIGR01136"
FT                   /protein_id="ADP72925.1"
FT                   /translation="MARTVNSVTELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVK
FT                   DRIALAMIEAAEKEGKIKPGDTIVEPTSGNTGIGLAMVAAAKGYKAILVMPDTMSLERR
FT                   NLLRAYGAELVLTPGSQGMRGAIAKAEELVKEHGYFMPQQFKNEANPEIHRLTTGKEIV
FT                   EQMGDQLDAFIAGVGTGGTITGAGQVLREKYPNIKIYAVEPADSPVLSGGKPGPHKIQG
FT                   IGAGFVPDILDTSIYDGVITVTTEEAFAAARRAAREEGILGGISSGAAIHAALKIAKQL
FT                   GKGKKVLAIIPSNGERYLSTPLYQFDE"
     MARTVNSVTE LIGDTPAVKL NRIVDEDSAD VYLKLEFMNP GSSVKDRIAL AMIEAAEKEG        60
     KIKPGDTIVE PTSGNTGIGL AMVAAAKGYK AILVMPDTMS LERRNLLRAY GAELVLTPGS       120
     QGMRGAIAKA EELVKEHGYF MPQQFKNEAN PEIHRLTTGK EIVEQMGDQL DAFIAGVGTG       180
     GTITGAGQVL REKYPNIKIY AVEPADSPVL SGGKPGPHKI QGIGAGFVPD ILDTSIYDGV       240
     ITVTTEEAFA AARRAAREEG ILGGISSGAA IHAALKIAKQ LGKGKKVLAI IPSNGERYLS       300
     TPLYQFDE                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page