(data stored in SCRATCH zone)

EMBL: CP002293.PE70

CP002293.PE70        Location/Qualifiers
FT   CDS             83542..84957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0070"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   KEGG: gtn:GTNG_0066 P-aminobenzoate synthase; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72926"
FT                   /db_xref="GOA:A0A0F6BHM5"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM5"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADP72926.1"
FT                   /translation="MRKWGNRKRRTLPYSNRDWFRQYKALAAHEPYHVLLESGQGGRYS
FT                   IIGLTPAGVIQAKENQLFISYHGETKWYEGNPLLSLKQWFAQFPLHFSKSELPFQGGAI
FT                   GYISYDCARYIEKIPSYAQDDLQLPSMYFLIFDDVFVYDHQKQLLHMIVHYADGEELEA
FT                   ERRLSFYESRWLEAEQCEGEWMFQKQDANPSVSMTKADFVEAVQKVQQYIAQGDVFQVN
FT                   LSVRQSKPLLTHPFHIYEQLRVINPSPYMAYIHFPEFQIVSGSPELLVKKRGDDISTRP
FT                   IAGTRSRGKTEEEDKWLATKLLSSEKEIAEHAMLVDLERNDLGRVCQYGTVKVDEWMTI
FT                   ERYSHVMHIVSHVSGKLKQGKDAFDVIQAMFPGGTITGAPKVRTMEIIEELEPVRRGIY
FT                   TGSIGWISFDGDMEFNIAIRTMIAKDGIAHVQAGAGIVIDSHPEHEYRECLKKAAALWK
FT                   AKELSEAEKSLRV"
     MRKWGNRKRR TLPYSNRDWF RQYKALAAHE PYHVLLESGQ GGRYSIIGLT PAGVIQAKEN        60
     QLFISYHGET KWYEGNPLLS LKQWFAQFPL HFSKSELPFQ GGAIGYISYD CARYIEKIPS       120
     YAQDDLQLPS MYFLIFDDVF VYDHQKQLLH MIVHYADGEE LEAERRLSFY ESRWLEAEQC       180
     EGEWMFQKQD ANPSVSMTKA DFVEAVQKVQ QYIAQGDVFQ VNLSVRQSKP LLTHPFHIYE       240
     QLRVINPSPY MAYIHFPEFQ IVSGSPELLV KKRGDDISTR PIAGTRSRGK TEEEDKWLAT       300
     KLLSSEKEIA EHAMLVDLER NDLGRVCQYG TVKVDEWMTI ERYSHVMHIV SHVSGKLKQG       360
     KDAFDVIQAM FPGGTITGAP KVRTMEIIEE LEPVRRGIYT GSIGWISFDG DMEFNIAIRT       420
     MIAKDGIAHV QAGAGIVIDS HPEHEYRECL KKAAALWKAK ELSEAEKSLR V                471
//

If you have problems or comments...

PBIL Back to PBIL home page