(data stored in SCRATCH zone)

EMBL: CP002293.PE72

CP002293.PE72        Location/Qualifiers
FT   CDS             85552..86421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0072"
FT                   /product="Aminodeoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /note="KEGG: gwc:GWCH70_0071 aminotransferase class IV;
FT                   PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72928"
FT                   /db_xref="GOA:A0A0F6BHM7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHM7"
FT                   /inference="protein motif:PRIAM:4.1.3.38"
FT                   /protein_id="ADP72928.1"
FT                   /translation="MYIYVNGEVVHKDEARISPFDHGFLYGLGVFETFRTYDGHPFLLD
FT                   DHLERLNRSLREMNIAKSFTRREVMEILHRLLEANRLQNAYVRLNVSAGIGDIGLQTSE
FT                   YDQPTVIMYMKPLFSSFSRGKIGIVLKTRRNTPEGKERLKSHHYLNNIIGKREIGTRPD
FT                   VEGIFLNEQGYVAEGIVSNIFWVKNGVVYTPAIHAGILNGVTRQFVIALLNALKIECQE
FT                   GFYPLDHLQRADEIFVTNSIQEIVPIYQMDGRAYQGADGPVTSLLQKHYKHFTSFLWTK
FT                   YELAERME"
     MYIYVNGEVV HKDEARISPF DHGFLYGLGV FETFRTYDGH PFLLDDHLER LNRSLREMNI        60
     AKSFTRREVM EILHRLLEAN RLQNAYVRLN VSAGIGDIGL QTSEYDQPTV IMYMKPLFSS       120
     FSRGKIGIVL KTRRNTPEGK ERLKSHHYLN NIIGKREIGT RPDVEGIFLN EQGYVAEGIV       180
     SNIFWVKNGV VYTPAIHAGI LNGVTRQFVI ALLNALKIEC QEGFYPLDHL QRADEIFVTN       240
     SIQEIVPIYQ MDGRAYQGAD GPVTSLLQKH YKHFTSFLWT KYELAERME                   289
//

If you have problems or comments...

PBIL Back to PBIL home page