(data stored in ACNUC7421 zone)

EMBL: CP002293.PE78

CP002293.PE78        Location/Qualifiers
FT   CDS             89437..90921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0078"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="KEGG: gwc:GWCH70_0078 lysyl-tRNA synthetase;
FT                   TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA synthetase class
FT                   II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72934"
FT                   /db_xref="GOA:A0A0F6BHN3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN3"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADP72934.1"
FT                   /translation="MSHEELNDQLRVRREKLHKLREMGIDPFGKRFERTHKAQELFDLY
FT                   GDLSKEELEEKQIKVAVAGRIMTKRGKGKAGFAHIQDVTGQIQIYVREDAVGPEQYELF
FT                   KTSDLGDIIGVCGTVFKTKVGELSIKVSSYEFLTKALRPLPEKYHGLKDIEQRYRQRYL
FT                   DLIMNPDSKNTFITRSRIIQSMRRYLDSHGYLEVETPMMHNIAGGAAARPFITHHNALD
FT                   MPLYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMLELYEAYADFRDI
FT                   MTLTENLIAHIAQEVLGTTKIQYGEHKVDLTPEWKRLHMVDAIKEYVGVDFWKQMSDEE
FT                   ARELAKEHGVEIAPHMTFGHIVNEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNPDDPR
FT                   FTDRFELFIVGREHANAFTELNDPIDQRERFEAQLKEREQGNDEAHEMDEDFIEALEYG
FT                   MPPTGGLGIGVDRLVMLLTNSPSIRDVLLFPQMRNK"
     MSHEELNDQL RVRREKLHKL REMGIDPFGK RFERTHKAQE LFDLYGDLSK EELEEKQIKV        60
     AVAGRIMTKR GKGKAGFAHI QDVTGQIQIY VREDAVGPEQ YELFKTSDLG DIIGVCGTVF       120
     KTKVGELSIK VSSYEFLTKA LRPLPEKYHG LKDIEQRYRQ RYLDLIMNPD SKNTFITRSR       180
     IIQSMRRYLD SHGYLEVETP MMHNIAGGAA ARPFITHHNA LDMPLYMRIA IELHLKRLIV       240
     GGLEKVYEIG RVFRNEGVST RHNPEFTMLE LYEAYADFRD IMTLTENLIA HIAQEVLGTT       300
     KIQYGEHKVD LTPEWKRLHM VDAIKEYVGV DFWKQMSDEE ARELAKEHGV EIAPHMTFGH       360
     IVNEFFEQKV EDKLIQPTFI YGHPVEISPL AKKNPDDPRF TDRFELFIVG REHANAFTEL       420
     NDPIDQRERF EAQLKEREQG NDEAHEMDED FIEALEYGMP PTGGLGIGVD RLVMLLTNSP       480
     SIRDVLLFPQ MRNK                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page