(data stored in SCRATCH zone)

EMBL: CP002293.PE79

CP002293.PE79        Location/Qualifiers
FT   CDS             102589..103050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0079"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: transcriptional repressor, CtsR"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72935"
FT                   /db_xref="GOA:A0A0F6BHN4"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN4"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ADP72935.1"
FT                   /translation="MPNISDIIEQYLKQVLNMSDKDIVEIKRSEIADKFQCVPSQINYV
FT                   INTRFTLERGYVVESKRGGGGYIRIMKVKTKSEAQLIDQLLELVGHHVSQSNAEDIIHR
FT                   LVEEKVISEREAKIMLSVMDRSVLCIDLPQRDELRARMLRAMLTSLKYK"
     MPNISDIIEQ YLKQVLNMSD KDIVEIKRSE IADKFQCVPS QINYVINTRF TLERGYVVES        60
     KRGGGGYIRI MKVKTKSEAQ LIDQLLELVG HHVSQSNAED IIHRLVEEKV ISEREAKIML       120
     SVMDRSVLCI DLPQRDELRA RMLRAMLTSL KYK                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page