(data stored in ACNUC7421 zone)

EMBL: CP002293.PE80

CP002293.PE80        Location/Qualifiers
FT   CDS             103065..103613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0080"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: gwc:GWCH70_0081
FT                   UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72936"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN5"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ADP72936.1"
FT                   /translation="MICQECKQRPATMHFTKIINGEKTEFHLCEQCAHEHSDMFTFYGN
FT                   DDFSFNNLLSALLNFPSSMKELTTSSFHNPDILQCEKCNMTYQQFTKIGHFGCSHCYRT
FT                   FSRYLPPILKRLHSGNTAHAGKIPKRKGGTLHLRKQIAMLKQKLQEFVAREEFEKAAEV
FT                   RDQIRSLEYQLHQRGEGEM"
     MICQECKQRP ATMHFTKIIN GEKTEFHLCE QCAHEHSDMF TFYGNDDFSF NNLLSALLNF        60
     PSSMKELTTS SFHNPDILQC EKCNMTYQQF TKIGHFGCSH CYRTFSRYLP PILKRLHSGN       120
     TAHAGKIPKR KGGTLHLRKQ IAMLKQKLQE FVAREEFEKA AEVRDQIRSL EYQLHQRGEG       180
     EM                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page