(data stored in ACNUC7421 zone)

EMBL: CP002293.PE81

CP002293.PE81        Location/Qualifiers
FT   CDS             103618..104700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0081"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   gwc:GWCH70_0082 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72937"
FT                   /db_xref="GOA:A0A0F6BHN6"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN6"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ADP72937.1"
FT                   /translation="MSFEKFFNTAVSSWMSQEGPDSDIVLSSRIRLARNIVDFRFPTLF
FT                   SNEEAQQIVSLFEQTFAHRFYRSVGRFELLKMSELQPIEKRVLVEKHLISPHLAEDSPF
FT                   GACLLSENEEISIMINEEDHIRIQCLFPGFQLTEALKAANELDDWIEEHVIYAFDEKLG
FT                   YLTSCPTNVGTGMRASVMMHLPALVLTQQMNRIIPAVNQLGLVVRGTYGEGSEALGNIF
FT                   QISNQMTLGKSEEDIVEDLKSVVQQLITQERMARETLVKTLNIQLEDRVFRSYGILANS
FT                   RVIDSKEAAQCLSDVRLGIDLGYIKNISRNILNELMILTQPGFLQQYAGGVLRPEERDV
FT                   RRAALIRERLKMEERKMNGG"
     MSFEKFFNTA VSSWMSQEGP DSDIVLSSRI RLARNIVDFR FPTLFSNEEA QQIVSLFEQT        60
     FAHRFYRSVG RFELLKMSEL QPIEKRVLVE KHLISPHLAE DSPFGACLLS ENEEISIMIN       120
     EEDHIRIQCL FPGFQLTEAL KAANELDDWI EEHVIYAFDE KLGYLTSCPT NVGTGMRASV       180
     MMHLPALVLT QQMNRIIPAV NQLGLVVRGT YGEGSEALGN IFQISNQMTL GKSEEDIVED       240
     LKSVVQQLIT QERMARETLV KTLNIQLEDR VFRSYGILAN SRVIDSKEAA QCLSDVRLGI       300
     DLGYIKNISR NILNELMILT QPGFLQQYAG GVLRPEERDV RRAALIRERL KMEERKMNGG       360
//

If you have problems or comments...

PBIL Back to PBIL home page