(data stored in SCRATCH zone)

EMBL: CP002293.PE83

CP002293.PE83        Location/Qualifiers
FT   CDS             107231..108604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0083"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; PFAM: Circadian
FT                   clock protein KaiC central region; KEGG: gwc:GWCH70_0084
FT                   DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72939"
FT                   /db_xref="GOA:A0A0F6BHN8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN8"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADP72939.1"
FT                   /translation="MGKKKTKFVCQECGYESAKWLGRCPGCNTWNSMVEEIERTKPATK
FT                   GVFVHSASDIISKPVPITTVTATQEPRIQTGISEFNRVLGGGIVKGSLVLIGGDPGIGK
FT                   STLLLQVSAQLAALQHKVLYISGEESVKQTKLRADRLHVASDQLYVLAETDLEYIVEAI
FT                   ETIHPVCVVIDSIQTIYRADIASAPGSVSQVRECTAELMKIAKTKGITIFIVGHVTKEG
FT                   AIAGPRILEHMVDTVLYFEGERHHTYRILRAVKNRFGSTNEIGIFEMRESGLVEVENPS
FT                   EVFLEERSRGAAGSTVVAAMEGTRPVLVEIQALVSPTSFGNPRRMATGIDHNRVSLLMA
FT                   VLEKRSGLLLQNQDAYLKVAGGVKLDEPAIDLAIAVSIASSFRDQPTNPHDVIIGEVGL
FT                   TGEVRRVSRIEQRVQEAVKLGFSRMIIPKNNLAGWNPPEHITVIGVSHITEALEHTLQ"
     MGKKKTKFVC QECGYESAKW LGRCPGCNTW NSMVEEIERT KPATKGVFVH SASDIISKPV        60
     PITTVTATQE PRIQTGISEF NRVLGGGIVK GSLVLIGGDP GIGKSTLLLQ VSAQLAALQH       120
     KVLYISGEES VKQTKLRADR LHVASDQLYV LAETDLEYIV EAIETIHPVC VVIDSIQTIY       180
     RADIASAPGS VSQVRECTAE LMKIAKTKGI TIFIVGHVTK EGAIAGPRIL EHMVDTVLYF       240
     EGERHHTYRI LRAVKNRFGS TNEIGIFEMR ESGLVEVENP SEVFLEERSR GAAGSTVVAA       300
     MEGTRPVLVE IQALVSPTSF GNPRRMATGI DHNRVSLLMA VLEKRSGLLL QNQDAYLKVA       360
     GGVKLDEPAI DLAIAVSIAS SFRDQPTNPH DVIIGEVGLT GEVRRVSRIE QRVQEAVKLG       420
     FSRMIIPKNN LAGWNPPEHI TVIGVSHITE ALEHTLQ                                457
//

If you have problems or comments...

PBIL Back to PBIL home page