(data stored in ACNUC7421 zone)

EMBL: CP002293.PE84

CP002293.PE84        Location/Qualifiers
FT   CDS             108716..109810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0084"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: gwc:GWCH70_0085 PilT protein domain protein;
FT                   PFAM: PilT protein domain protein; deoxyribonuclease/rho
FT                   motif-related TRAM; SMART: Nucleotide binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72940"
FT                   /db_xref="GOA:A0A0F6BHN9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHN9"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADP72940.1"
FT                   /translation="MVKRIVQLFFLVVGGTLGVVFLPNLLQLMNISDISLLNNSYTLAV
FT                   LGALIFFMMTFWLVDYVVDMIRWVEETLVKAPAADLLFGSLGLIFGLIVAFLVVMPLQA
FT                   FQFQVVNTVLPIFLTILLGYLGFQVGFKKRHELMNLFSLSNRMAKKKGTEGETDLPKGG
FT                   SLKILDTSVIIDGRIADICKTGFLEGTLVIPRFVLEELQHIADSSDVLKRNRGRRGLDI
FT                   LNRIQKELDIKVEIYEGDFDDIQEVDSKLVKLAKLTSGVVVTNDFNLNKVCELQNVRVL
FT                   NINDLANAVKPVVLPGEELNVHVIKDGKEHNQGVAYLDDGTMIVVEDGKEYIGKRVDVL
FT                   VTSVLQTSAGRMIFAKLKLLQKAL"
     MVKRIVQLFF LVVGGTLGVV FLPNLLQLMN ISDISLLNNS YTLAVLGALI FFMMTFWLVD        60
     YVVDMIRWVE ETLVKAPAAD LLFGSLGLIF GLIVAFLVVM PLQAFQFQVV NTVLPIFLTI       120
     LLGYLGFQVG FKKRHELMNL FSLSNRMAKK KGTEGETDLP KGGSLKILDT SVIIDGRIAD       180
     ICKTGFLEGT LVIPRFVLEE LQHIADSSDV LKRNRGRRGL DILNRIQKEL DIKVEIYEGD       240
     FDDIQEVDSK LVKLAKLTSG VVVTNDFNLN KVCELQNVRV LNINDLANAV KPVVLPGEEL       300
     NVHVIKDGKE HNQGVAYLDD GTMIVVEDGK EYIGKRVDVL VTSVLQTSAG RMIFAKLKLL       360
     QKAL                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page