(data stored in ACNUC7421 zone)

EMBL: CP002293.PE87

CP002293.PE87        Location/Qualifiers
FT   CDS             111122..112582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0087"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="KEGG: gwc:GWCH70_0088 glutamyl-tRNA synthetase;
FT                   TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72943"
FT                   /db_xref="GOA:A0A0F6BHP2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP2"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADP72943.1"
FT                   /translation="MSQEVRVRYAPSPTGHLHIGGARTALFNYLFARHHNGKFIVRIED
FT                   TDIERNVEGGEQSQLENLKWLGIDYDESVDKDGGYGPYRQTERLDIYRKYVNELLEKGY
FT                   AYKCFCTPEELEQEREAQRAAGIAAPQYSGKCRHLTKEQIAQLEAEGKPYTIRVKVPEG
FT                   KVYEFEDIVRGKVTFESKDIGDWVIMKANGIPTYNFAVVIDDHLMKITHVFRGEEHLSN
FT                   TPKQLMIYDYFGWEPPQFGHLTLIVNENRKKLSKRDESIIQFVSQYKELGYLPEALFNF
FT                   FALLGWSPEGEEEIFSKEELIRIFDVSRLSKSPSMFDTKKLTWMNNQYIKKLDLDRLVE
FT                   ISLPHLIKAGRLPEQMSEEQRQWARDLIALYQEQMSYGAEIVQLSELFFKEDIEYNEEA
FT                   KEVLSGEQVPDVLKAFLEEVKQLDPFTAENIKAAIKSVQKSTGQKGKKLFMPIRVAATG
FT                   QTHGPELPVALQLLGKEKVISRLEKVVH"
     MSQEVRVRYA PSPTGHLHIG GARTALFNYL FARHHNGKFI VRIEDTDIER NVEGGEQSQL        60
     ENLKWLGIDY DESVDKDGGY GPYRQTERLD IYRKYVNELL EKGYAYKCFC TPEELEQERE       120
     AQRAAGIAAP QYSGKCRHLT KEQIAQLEAE GKPYTIRVKV PEGKVYEFED IVRGKVTFES       180
     KDIGDWVIMK ANGIPTYNFA VVIDDHLMKI THVFRGEEHL SNTPKQLMIY DYFGWEPPQF       240
     GHLTLIVNEN RKKLSKRDES IIQFVSQYKE LGYLPEALFN FFALLGWSPE GEEEIFSKEE       300
     LIRIFDVSRL SKSPSMFDTK KLTWMNNQYI KKLDLDRLVE ISLPHLIKAG RLPEQMSEEQ       360
     RQWARDLIAL YQEQMSYGAE IVQLSELFFK EDIEYNEEAK EVLSGEQVPD VLKAFLEEVK       420
     QLDPFTAENI KAAIKSVQKS TGQKGKKLFM PIRVAATGQT HGPELPVALQ LLGKEKVISR       480
     LEKVVH                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page