(data stored in ACNUC7421 zone)

EMBL: CP002293.PE89

CP002293.PE89        Location/Qualifiers
FT   CDS             113577..114977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0089"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="SMART: Cysteinyl-tRNA synthetase class Ia DALR;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; KEGG: gwc:GWCH70_0090
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia ; Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72945"
FT                   /db_xref="GOA:A0A0F6BHP4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP4"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADP72945.1"
FT                   /translation="MSSIRLYNTLTRKKEPFEPLEPNKVKMYVCGPTVYNYIHIGNARA
FT                   AIVFDTIRRYLEFRGYEVKYVSNFTDVDDKLIKAARELGEDVPTVAERFIQAYFEDITA
FT                   LGCKKADVHPRVTENMDTIIEFIQALVEKGYAYEVDGDVYYRTRKFAEYGKLSHQSIDE
FT                   LKAGARIEIGEKKEDPLDFALWKAAKEGEICWDSPWGKGRPGWHIECSAMARKYLGDTI
FT                   DIHAGGQDLTFPHHENEIAQSEALTGKPFAKYWLHNGYLNINNEKMSKSLGNFVLVHDI
FT                   IRQIDPQVLRFFMLSVHYRHPINYSEELLENAKKGLERLKTAYFNLKHRLQSSTNLTDD
FT                   DEQWLARIQEQHEAFIREMDDDFNTANGIAVLFELAKQANLYLHEKNTSERVIHAFLRE
FT                   LEQLLDVLGITLQEEELLDEEIEALIQKRNEARKNRNFALADQIRDELRAKNIILEDTP
FT                   QGTRWKRG"
     MSSIRLYNTL TRKKEPFEPL EPNKVKMYVC GPTVYNYIHI GNARAAIVFD TIRRYLEFRG        60
     YEVKYVSNFT DVDDKLIKAA RELGEDVPTV AERFIQAYFE DITALGCKKA DVHPRVTENM       120
     DTIIEFIQAL VEKGYAYEVD GDVYYRTRKF AEYGKLSHQS IDELKAGARI EIGEKKEDPL       180
     DFALWKAAKE GEICWDSPWG KGRPGWHIEC SAMARKYLGD TIDIHAGGQD LTFPHHENEI       240
     AQSEALTGKP FAKYWLHNGY LNINNEKMSK SLGNFVLVHD IIRQIDPQVL RFFMLSVHYR       300
     HPINYSEELL ENAKKGLERL KTAYFNLKHR LQSSTNLTDD DEQWLARIQE QHEAFIREMD       360
     DDFNTANGIA VLFELAKQAN LYLHEKNTSE RVIHAFLREL EQLLDVLGIT LQEEELLDEE       420
     IEALIQKRNE ARKNRNFALA DQIRDELRAK NIILEDTPQG TRWKRG                      466
//

If you have problems or comments...

PBIL Back to PBIL home page