(data stored in ACNUC7421 zone)

EMBL: CP002293.PE9

CP002293.PE9         Location/Qualifiers
FT   CDS             17076..18542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0009"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase; KEGG:
FT                   gwc:GWCH70_0009 inosine-5'-monophosphate dehydrogenase;
FT                   PFAM: IMP dehydrogenase/GMP reductase; CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72865"
FT                   /db_xref="GOA:A0A0F6BHG4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHG4"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ADP72865.1"
FT                   /translation="MWESKFAKEGLTFDDVLLIPAKSDVLPRDVDVTTKLSETLQLNIP
FT                   IISAGMDTVTEAEMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSERGVITDPFFLTP
FT                   EHQVYDAEHLMSKYRISGVPIVNNEEEQKLVGIITNRDLRFIQDYSTKISDVMTKENLI
FT                   TAPVGTTLEEAEKILQKYKVEKLPLVDENGILKGLITIKDIEKVIEFPNSAKDAKGRLL
FT                   VGAAVGVTADTMIRVKKLVEANVDVIVVDTAHGHSKGVLETVRKIREQYPDLNIIAGNV
FT                   ATAEATRDLIEAGANIIKVGIGPGSICTTRVVAGVGVPQITAIYDCATEARKHGVPIIA
FT                   DGGIKYSGDIVKALAAGAHAVMLGSLLAGVSESPGETEIYQGRRFKVYRGMGSVAAMEK
FT                   GSKDRYFQEDNKKFVPEGIEGRVPYKGPLADTIYQLVGGLRAGMGYCGTRNLEELREKT
FT                   QFIRMTSAGLRESHPHDVQITKEAPNYSIS"
     MWESKFAKEG LTFDDVLLIP AKSDVLPRDV DVTTKLSETL QLNIPIISAG MDTVTEAEMA        60
     IAMARQGGLG IIHKNMSIEQ QAEQVDKVKR SERGVITDPF FLTPEHQVYD AEHLMSKYRI       120
     SGVPIVNNEE EQKLVGIITN RDLRFIQDYS TKISDVMTKE NLITAPVGTT LEEAEKILQK       180
     YKVEKLPLVD ENGILKGLIT IKDIEKVIEF PNSAKDAKGR LLVGAAVGVT ADTMIRVKKL       240
     VEANVDVIVV DTAHGHSKGV LETVRKIREQ YPDLNIIAGN VATAEATRDL IEAGANIIKV       300
     GIGPGSICTT RVVAGVGVPQ ITAIYDCATE ARKHGVPIIA DGGIKYSGDI VKALAAGAHA       360
     VMLGSLLAGV SESPGETEIY QGRRFKVYRG MGSVAAMEKG SKDRYFQEDN KKFVPEGIEG       420
     RVPYKGPLAD TIYQLVGGLR AGMGYCGTRN LEELREKTQF IRMTSAGLRE SHPHDVQITK       480
     EAPNYSIS                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page