(data stored in SCRATCH zone)

EMBL: CP002293.PE90

CP002293.PE90        Location/Qualifiers
FT   CDS             114983..115402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0090"
FT                   /product="ribonuclease III"
FT                   /note="KEGG: gwc:GWCH70_0091 ribonuclease III; PFAM:
FT                   ribonuclease III; SMART: ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72946"
FT                   /db_xref="GOA:A0A0F6BHP5"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP5"
FT                   /inference="protein motif:PFAM:PF00636"
FT                   /protein_id="ADP72946.1"
FT                   /translation="MNLLQPVKDVKQMNGLTLAYIGDAVYELYVRHHLLSSGNVKPHQL
FT                   HKRAIQYVSAKAQAKVLLTLLENGILTEEEQSVVRRGRNAKSGTIPKNTDVQTYRYSTA
FT                   FEALIGYHFLGNNEKRVEELIRNSFVIIESEERKS"
     MNLLQPVKDV KQMNGLTLAY IGDAVYELYV RHHLLSSGNV KPHQLHKRAI QYVSAKAQAK        60
     VLLTLLENGI LTEEEQSVVR RGRNAKSGTI PKNTDVQTYR YSTAFEALIG YHFLGNNEKR       120
     VEELIRNSFV IIESEERKS                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page