(data stored in ACNUC7421 zone)

EMBL: CP002293.PE92

CP002293.PE92        Location/Qualifiers
FT   CDS             116147..116659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GY4MC1_0092"
FT                   /product="protein of unknown function DUF901"
FT                   /note="PFAM: protein of unknown function DUF901; KEGG:
FT                   gwc:GWCH70_0093 protein of unknown function DUF901"
FT                   /db_xref="EnsemblGenomes-Gn:GY4MC1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADP72948"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F6BHP7"
FT                   /inference="protein motif:PFAM:PF05991"
FT                   /protein_id="ADP72948.1"
FT                   /translation="MNILIVDGYNMIGAWPELRKLKEEDDLAAARDLLISKMAEYQGFT
FT                   GDKVIIVFDAHLVQGNAKKYKNHQVEVIFTKENETADERIERLAKSLINVRTKVYVATS
FT                   DYTEQWTIFSQGALRKSARELLMEMESIEKAISKKLQNMKEQTPASRVPLPDEVARIFE
FT                   KWRRGQK"
     MNILIVDGYN MIGAWPELRK LKEEDDLAAA RDLLISKMAE YQGFTGDKVI IVFDAHLVQG        60
     NAKKYKNHQV EVIFTKENET ADERIERLAK SLINVRTKVY VATSDYTEQW TIFSQGALRK       120
     SARELLMEME SIEKAISKKL QNMKEQTPAS RVPLPDEVAR IFEKWRRGQK                  170
//

If you have problems or comments...

PBIL Back to PBIL home page